PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g095190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 745aa    MW: 83046.7 Da    PI: 6.5594
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g095190.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox665.2e-2198153156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     r+k +++t++q++ +e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  Csa09g095190.1  98 RKKYHRHTTDQIRHMEALFKETPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIK 153
                     7999************************************************9877 PP

2START235.51.4e-732564831206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                     e+a++a+ el+k+a+++ep+W +s+    e++n+de+l++f+++++      +++ea+r++g+v+m++++l ++++d++ qW+e++a    ka+t
  Csa09g095190.1 256 EIANRATLELQKMATSGEPLWLRSVetgrEILNYDEYLKEFPQAQAssfpgrKTIEASRDVGIVFMDAHKLAQSFMDVG-QWKEMFAclvsKAAT 349
                     578999*************************************999*********************************.*************** PP

                     EEEECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
           START  82 levissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwv 167
                     ++vi++g       ga+qlm+ e+q+l+p+vp R+++fvR++rql+ ++w+ivdvSv++e++++e ++s+ ++++lpSg++ie++snghskvtwv
  Csa09g095190.1 350 VDVIRQGegpsridGAIQLMFGEMQLLTPVVPtREVYFVRSCRQLTPEKWAIVDVSVSVEDSNTEkEASLLKCRKLPSGCIIEDTSNGHSKVTWV 444
                     *********************************************************************************************** PP

                     E-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     eh d++++++h l+rslv++gla+ga++wvatlq +ce+
  Csa09g095190.1 445 EHLDVSASTVHPLFRSLVNTGLAFGARHWVATLQLHCER 483
                     *************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-2384149IPR009057Homeodomain-like
SuperFamilySSF466894.05E-2088156IPR009057Homeodomain-like
PROSITE profilePS5007117.81595155IPR001356Homeobox domain
SMARTSM003899.6E-1897159IPR001356Homeobox domain
PfamPF000462.6E-1898153IPR001356Homeobox domain
CDDcd000862.16E-16102153No hitNo description
PROSITE patternPS000270130153IPR017970Homeobox, conserved site
PROSITE profilePS5084843.618247486IPR002913START domain
SuperFamilySSF559612.12E-31250483No hitNo description
CDDcd088753.50E-111251482No hitNo description
PfamPF018524.6E-67256483IPR002913START domain
SMARTSM002344.8E-85256483IPR002913START domain
Gene3DG3DSA:3.30.530.205.4E-8297482IPR023393START-like domain
SuperFamilySSF559619.42E-16512729No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MSMAVEMSSK QPTKDFFSSP ALSLSLAGIF RNASSGNTDP AEEDFLSRRV VDDEDRTVEM  60
SSENSGPTRS RSEEDLEGED HEEDLEDDDG NKGNKRKRKK YHRHTTDQIR HMEALFKETP  120
HPDEKQRQQL SKQLGLAPRQ VKFWFQNRRT QIKAIQERHE NSLLKAELEK LREENKAMRE  180
SFSKAANSSC PNCGGGPDDL HLENSKLKAE LDKLRAALGR TPYPLQASCS EDQEQRLGSL  240
DFYTGVFALE KSRIAEIANR ATLELQKMAT SGEPLWLRSV ETGREILNYD EYLKEFPQAQ  300
ASSFPGRKTI EASRDVGIVF MDAHKLAQSF MDVGQWKEMF ACLVSKAATV DVIRQGEGPS  360
RIDGAIQLMF GEMQLLTPVV PTREVYFVRS CRQLTPEKWA IVDVSVSVED SNTEKEASLL  420
KCRKLPSGCI IEDTSNGHSK VTWVEHLDVS ASTVHPLFRS LVNTGLAFGA RHWVATLQLH  480
CERLVFFMAT NVPTKDSLGV TTLAGRKSVL KMAQRMTQSF YRAIAASSYH QWTKITTKTG  540
QDMRVSSRKN LHDPGEPTGV IVCASSSLWL PVSPTLLFDF FRDEARRHEW DALSNGAHVQ  600
SIASLSKGQD RGNSVAIQTV KSREKSIWVL QDSSTNSYES VVVYAPVDIN TTQLVLAGHD  660
PSNIQILPCG FSIIPDGVES RPLVITTTQD DRNSQGGSLL TLALQTLINP SPAAKLNMES  720
VDSVTNLVSV TLHNIRRSLQ IEDC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19599RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3602940.0AF360294.1 Arabidopsis thaliana putative homeobox protein GLABRA2 (At1g79840) mRNA, complete cds.
GenBankBT0019560.0BT001956.1 Arabidopsis thaliana clone U09291 putative homeobox protein GLABRA2 (At1g79840) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010430051.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2-like
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLF4HQC00.0F4HQC0_ARATH; Homeobox-leucine zipper protein GLABRA 2
STRINGAT1G79840.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM123702731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein